Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species) |
Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (8 PDB entries) Uniprot P19866 |
Domain d1rm3o1: 1rm3 O:1-148,O:313-333 [104998] Other proteins in same PDB: d1rm3a2, d1rm3b2, d1rm3o2 complexed with ndp, so4; mutant |
PDB Entry: 1rm3 (more details), 2.2 Å
SCOPe Domain Sequences for d1rm3o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rm3o1 c.2.1.3 (O:1-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} lkvaingfgrigrnflrcwhgrkdspldvvvindaggvkqashllkydsilgtfdadvkt agdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvli tapgkgdiptyvvgvneegythadtiisnasXnewgysqrvvdladivankwq
Timeline for d1rm3o1:
View in 3D Domains from other chains: (mouse over for more information) d1rm3a1, d1rm3a2, d1rm3b1, d1rm3b2 |