SCOP 1.69: Domain d1rm3a2: 1rm3 A:149-312

Lineage for d1rm3a2 (1rm3 A:149-312)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (4 proteins)
   has many additional secondary structures

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [69769] (5 PDB entries)

8. Domain d1rm3a2: 1rm3 A:149-312 [104995]
   Other proteins in same PDB: d1rm3a1, d1rm3b1, d1rm3o1

Details for d1rm3a2

PDB Entry: 1rm3, 2.2 Å

PDB Description: crystal structure of mutant t33a of photosynthetic glyceraldehyde-3- phosphate dehydrogenase a4 isoform, complexed with nadp

SCOP Domain Sequences for d1rm3a2:

Sequence; same for both SEQRES and ATOM records:

>d1rm3a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea)}
cttnclapfvkvldqkfgiikgtmttthsytgdqrlldashrdlrraraaclnivptstg
aakavalvlpnlkgklngialrvptpnvsvvdlvvqvskktfaeevnaafresadnelkg
ilsvcdeplvsidfrctdvsstidssltmvmgddmvkviawyd

Timeline for d1rm3a2:

• d1rm3a2 is new in SCOP 1.69
  
• d1rm3a2 appears in SCOP 1.71
  
• d1rm3a2 appears in the current release, SCOPe 2.08