SCOPe 2.08: Domain d1rm0b2: 1rm0 B:323-437

Lineage for d1rm0b2 (1rm0 B:323-437)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)

6. Protein Myo-inositol 1-phosphate synthase [75484] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75486] (9 PDB entries)
   Uniprot P11986

8. Domain d1rm0b2: 1rm0 B:323-437 [104993]
   Other proteins in same PDB: d1rm0a1, d1rm0b1
   complexed with d6p, mn, nai

Details for d1rm0b2

PDB Entry: 1rm0, 2.05 Å

PDB Description: Crystal Structure of Myo-Inositol 1-Phosphate Synthase From Saccharomyces cerevisiae In Complex With NAD+ and 2-deoxy-D-glucitol 6-(E)-vinylhomophosphonate

PDB Compounds: (B:) myo-inositol-phosphate synthase

SCOPe Domain Sequences for d1rm0b2:

Sequence; same for both SEQRES and ATOM records:

>d1rm0b2 d.81.1.3 (B:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrskeiskssviddiia
sndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce

Timeline for d1rm0b2:

• d1rm0b2 first appeared in SCOP 1.69
  
• d1rm0b2 appears in SCOPe 2.07