![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins) |
![]() | Protein Myo-inositol 1-phosphate synthase [75484] (4 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75486] (9 PDB entries) Uniprot P11986 |
![]() | Domain d1rm0a2: 1rm0 A:323-437 [104991] Other proteins in same PDB: d1rm0a1, d1rm0b1 complexed with d6p, mn, nai |
PDB Entry: 1rm0 (more details), 2.05 Å
SCOPe Domain Sequences for d1rm0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rm0a2 d.81.1.3 (A:323-437) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sgqtklksvlaqflvdagikpvsiasynhlgnndgynlsapkqfrskeiskssviddiia sndilyndklgkkvdhcivikymkpvgdskvamdeyyselmlgghnrisihnvce
Timeline for d1rm0a2: