Lineage for d1rm0a1 (1rm0 A:10-322,A:438-533)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2844066Protein Myo-inositol 1-phosphate synthase [75105] (4 species)
  7. 2844074Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75107] (9 PDB entries)
    Uniprot P11986
  8. 2844077Domain d1rm0a1: 1rm0 A:10-322,A:438-533 [104990]
    Other proteins in same PDB: d1rm0a2, d1rm0b2
    complexed with d6p, mn, nai
    has additional subdomain(s) that are not in the common domain

Details for d1rm0a1

PDB Entry: 1rm0 (more details), 2.05 Å

PDB Description: Crystal Structure of Myo-Inositol 1-Phosphate Synthase From Saccharomyces cerevisiae In Complex With NAD+ and 2-deoxy-D-glucitol 6-(E)-vinylhomophosphonate
PDB Compounds: (A:) myo-inositol-phosphate synthase

SCOPe Domain Sequences for d1rm0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rm0a1 c.2.1.3 (A:10-322,A:438-533) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim
liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap
fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd
fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter
yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla
ehegtfiagddlkXdsllatpliidllvmtefctrvsykkvdpvkedagkfenfypvltf
lsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll

SCOPe Domain Coordinates for d1rm0a1:

Click to download the PDB-style file with coordinates for d1rm0a1.
(The format of our PDB-style files is described here.)

Timeline for d1rm0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rm0a2