![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Myo-inositol 1-phosphate synthase [75105] (4 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75107] (9 PDB entries) Uniprot P11986 |
![]() | Domain d1rm0a1: 1rm0 A:10-322,A:438-533 [104990] Other proteins in same PDB: d1rm0a2, d1rm0b2 complexed with d6p, mn, nai has additional subdomain(s) that are not in the common domain |
PDB Entry: 1rm0 (more details), 2.05 Å
SCOPe Domain Sequences for d1rm0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rm0a1 c.2.1.3 (A:10-322,A:438-533) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgim liglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvyap fnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyypd fiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtanter yvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvqla ehegtfiagddlkXdsllatpliidllvmtefctrvsykkvdpvkedagkfenfypvltf lsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
Timeline for d1rm0a1: