SCOP 1.75: Domain d1rlub1: 1rlu B:8-205

Lineage for d1rlub1 (1rlu B:8-205)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family)

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins)

6. Protein Cell-division protein FtsZ [52492] (4 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [110501] (5 PDB entries)
   Uniprot O08378

8. Domain d1rlub1: 1rlu B:8-205 [104986]
   Other proteins in same PDB: d1rlua2, d1rlub2
   complexed with gol, gsp

Details for d1rlub1

PDB Entry: 1rlu, 2.08 Å

PDB Description: mycobacterium tuberculosis ftsz in complex with gtp-gamma-s

PDB Compounds: (B:) cell division protein ftsz

SCOP Domain Sequences for d1rlub1:

Sequence, based on SEQRES records:

>d1rlub1 c.32.1.1 (B:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstrglg
agadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvg
vvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevl
lngvqgitdlittpglin

Sequence, based on observed residues (ATOM records):

>d1rlub1 c.32.1.1 (B:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgadpevgrk
aaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvgvvtrpfsfeg
krrsnqaengiaalrescdtlivipndrllqmvslmdafrsadevllngvqgitdlittp
glin

Timeline for d1rlub1:

• d1rlub1 first appeared in SCOP 1.69
  
• d1rlub1 appears in SCOP 1.73
  
• d1rlub1 appears in SCOPe 2.01
  
• d1rlub1 appears in the current release, SCOPe 2.08