Lineage for d1rlub1 (1rlu B:8-205)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863169Protein Cell-division protein FtsZ [52492] (9 species)
  7. 2863200Species Mycobacterium tuberculosis [TaxId:1773] [110501] (6 PDB entries)
    Uniprot O08378
  8. 2863204Domain d1rlub1: 1rlu B:8-205 [104986]
    Other proteins in same PDB: d1rlua2, d1rlub2
    complexed with gol, gsp

Details for d1rlub1

PDB Entry: 1rlu (more details), 2.08 Å

PDB Description: mycobacterium tuberculosis ftsz in complex with gtp-gamma-s
PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d1rlub1:

Sequence, based on SEQRES records: (download)

>d1rlub1 c.32.1.1 (B:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstrglg
agadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvg
vvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevl
lngvqgitdlittpglin

Sequence, based on observed residues (ATOM records): (download)

>d1rlub1 c.32.1.1 (B:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgadpevgrk
aaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvgvvtrpfsfeg
krrsnqaengiaalrescdtlivipndrllqmvslmdafrsadevllngvqgitdlittp
glin

SCOPe Domain Coordinates for d1rlub1:

Click to download the PDB-style file with coordinates for d1rlub1.
(The format of our PDB-style files is described here.)

Timeline for d1rlub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rlub2