![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (1 family) ![]() |
![]() | Family c.32.1.1: Tubulin, GTPase domain [52491] (3 proteins) |
![]() | Protein Cell-division protein FtsZ [52492] (3 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [110501] (3 PDB entries) |
![]() | Domain d1rlua1: 1rlu A:8-205 [104984] Other proteins in same PDB: d1rlua2, d1rlub2 |
PDB Entry: 1rlu (more details), 2.08 Å
SCOP Domain Sequences for d1rlua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlua1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis} lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstrglg agadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvg vvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevl lngvqgitdlittpglin
Timeline for d1rlua1: