Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein Cell-division protein FtsZ [52492] (9 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [110501] (6 PDB entries) Uniprot O08378 |
Domain d1rlua1: 1rlu A:8-205 [104984] Other proteins in same PDB: d1rlua2, d1rlub2 complexed with gol, gsp |
PDB Entry: 1rlu (more details), 2.08 Å
SCOPe Domain Sequences for d1rlua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlua1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]} lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstrglg agadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvg vvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevl lngvqgitdlittpglin
Timeline for d1rlua1: