Lineage for d1rlja1 (1rlj A:1-126)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2465110Family c.23.5.7: Flavoprotein NrdI [110477] (1 protein)
    automatically mapped to Pfam PF07972
  6. 2465111Protein Flavoprotein NrdI [110478] (1 species)
  7. 2465112Species Bacillus subtilis [TaxId:1423] [110479] (1 PDB entry)
    Uniprot P50618
  8. 2465113Domain d1rlja1: 1rlj A:1-126 [104983]
    Other proteins in same PDB: d1rlja2
    Structural genomics target
    complexed with fmn, iod

Details for d1rlja1

PDB Entry: 1rlj (more details), 2 Å

PDB Description: Structural Genomics, a Flavoprotein NrdI from Bacillus subtilis
PDB Compounds: (A:) NrdI protein

SCOPe Domain Sequences for d1rlja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlja1 c.23.5.7 (A:1-126) Flavoprotein NrdI {Bacillus subtilis [TaxId: 1423]}
mvqiifdsktgnvqrfvnktgfqqirkvdemdhvdtpfvlvtyttnfgqvpastqsflek
yahlllgvaasgnkvwgdnfaksadtisrqyqvpilhkfelsgtskdvelftqevervvt
kssakm

SCOPe Domain Coordinates for d1rlja1:

Click to download the PDB-style file with coordinates for d1rlja1.
(The format of our PDB-style files is described here.)

Timeline for d1rlja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rlja2