Lineage for d1rlja_ (1rlj A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481332Superfamily c.23.5: Flavoproteins [52218] (7 families) (S)
  5. 481514Family c.23.5.7: Flavoprotein NrdI [110477] (1 protein)
  6. 481515Protein Flavoprotein NrdI [110478] (1 species)
  7. 481516Species Bacillus subtilis [TaxId:1423] [110479] (1 PDB entry)
  8. 481517Domain d1rlja_: 1rlj A: [104983]
    Structural genomics target

Details for d1rlja_

PDB Entry: 1rlj (more details), 2 Å

PDB Description: Structural Genomics, a Flavoprotein NrdI from Bacillus subtilis

SCOP Domain Sequences for d1rlja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlja_ c.23.5.7 (A:) Flavoprotein NrdI {Bacillus subtilis}
enlyfqsnamvqiifdsktgnvqrfvnktgfqqirkvdemdhvdtpfvlvtyttnfgqvp
astqsflekyahlllgvaasgnkvwgdnfaksadtisrqyqvpilhkfelsgtskdvelf
tqevervvtkssakm

SCOP Domain Coordinates for d1rlja_:

Click to download the PDB-style file with coordinates for d1rlja_.
(The format of our PDB-style files is described here.)

Timeline for d1rlja_: