![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.7: Flavoprotein NrdI [110477] (1 protein) automatically mapped to Pfam PF07972 |
![]() | Protein Flavoprotein NrdI [110478] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [110479] (1 PDB entry) Uniprot P50618 |
![]() | Domain d1rlja1: 1rlj A:1-126 [104983] Other proteins in same PDB: d1rlja2 Structural genomics target complexed with fmn, iod |
PDB Entry: 1rlj (more details), 2 Å
SCOPe Domain Sequences for d1rlja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlja1 c.23.5.7 (A:1-126) Flavoprotein NrdI {Bacillus subtilis [TaxId: 1423]} mvqiifdsktgnvqrfvnktgfqqirkvdemdhvdtpfvlvtyttnfgqvpastqsflek yahlllgvaasgnkvwgdnfaksadtisrqyqvpilhkfelsgtskdvelftqevervvt kssakm
Timeline for d1rlja1: