![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.3: L30e-like [55315] (4 families) ![]() |
![]() | Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) |
![]() | Protein Ribosomal protein L7ae [55319] (7 species) |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [111034] (1 PDB entry) Uniprot O29494 # AF0764 |
![]() | Domain d1rlga_: 1rlg A: [104981] protein/RNA complex |
PDB Entry: 1rlg (more details), 2.7 Å
SCOPe Domain Sequences for d1rlga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeoglobus fulgidus [TaxId: 2234]} vpedmqnealsllekvresgkvkkgtnettkaverglaklvyiaedvdppeivahlpllc eeknvpyiyvkskndlgravgievpcasaaiinegelrkelgslvekikglqk
Timeline for d1rlga_: