Lineage for d1rlga_ (1rlg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960097Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2960098Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2960115Protein Ribosomal protein L7ae [55319] (7 species)
  7. 2960118Species Archaeoglobus fulgidus [TaxId:2234] [111034] (1 PDB entry)
    Uniprot O29494 # AF0764
  8. 2960119Domain d1rlga_: 1rlg A: [104981]
    protein/RNA complex

Details for d1rlga_

PDB Entry: 1rlg (more details), 2.7 Å

PDB Description: molecular basis of box c/d rna-protein interaction: co-crystal structure of the archaeal srnp intiation complex
PDB Compounds: (A:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d1rlga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeoglobus fulgidus [TaxId: 2234]}
vpedmqnealsllekvresgkvkkgtnettkaverglaklvyiaedvdppeivahlpllc
eeknvpyiyvkskndlgravgievpcasaaiinegelrkelgslvekikglqk

SCOPe Domain Coordinates for d1rlga_:

Click to download the PDB-style file with coordinates for d1rlga_.
(The format of our PDB-style files is described here.)

Timeline for d1rlga_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rlgb_