Lineage for d1rlga_ (1rlg A:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.3: L30e-like [55315] (4 families) 
Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) 
Protein Ribosomal protein L7ae [55319] (7 species) 
Species Archaeoglobus fulgidus [TaxId:2234] [111034] (1 PDB entry)
Uniprot O29494 # AF0764
Domain d1rlga_: 1rlg A: [104981]
protein/RNA complex
Details for d1rlga_
PDB Entry: 1rlg (more details), 2.7 Å
PDB Description: molecular basis of box c/d rna-protein interaction: co-crystal structure of the archaeal srnp intiation complex
PDB Compounds: (A:) 50S ribosomal protein L7AeSCOPe Domain Sequences for d1rlga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlga_ d.79.3.1 (A:) Ribosomal protein L7ae {Archaeoglobus fulgidus [TaxId: 2234]}
vpedmqnealsllekvresgkvkkgtnettkaverglaklvyiaedvdppeivahlpllc
eeknvpyiyvkskndlgravgievpcasaaiinegelrkelgslvekikglqk
SCOPe Domain Coordinates for d1rlga_:
Click to download the PDB-style file with coordinates for d1rlga_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rlga_:
- d1rlga_ first appeared in SCOP 1.69
- d1rlga_ appears in SCOPe 2.07
View in 3D
