SCOP 1.75: Domain d1rl9a2: 1rl9 A:96-357

Lineage for d1rl9a2 (1rl9 A:96-357)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families)

5. Family d.128.1.2: Guanido kinase catalytic domain [55935] (2 proteins)

6. Protein Arginine kinase, C-terminal domain [55942] (1 species)

7. Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [55943] (7 PDB entries)
   Uniprot P51541

8. Domain d1rl9a2: 1rl9 A:96-357 [104980]
   Other proteins in same PDB: d1rl9a1
   complexed with adp, iom, mg

Details for d1rl9a2

PDB Entry: 1rl9, 1.45 Å

PDB Description: Crystal structure of Creatine-ADP arginine kinase ternary complex

PDB Compounds: (A:) arginine kinase

SCOP Domain Sequences for d1rl9a2:

Sequence; same for both SEQRES and ATOM records:

>d1rl9a2 d.128.1.2 (A:96-357) Arginine kinase, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
tdkhppkewgdintlvdldpagqfiistrvrcgrslqgypfnpcltaeqykemeekvsst
lssmedelkgtyypltgmskatqqqliddhflfkegdrflqtanacrywptgrgifhnda
ktflvwvneedhlriismqkggdlktvykrlvtavdniesklpfshddrfgfltfcptnl
gttmrasvhiqlpklakdrkvlediaskfnlqvrgtrgehteseggvydisnkrrlglte
yqavremqdgilemikmekaaa

Timeline for d1rl9a2:

• d1rl9a2 first appeared in SCOP 1.69
  
• d1rl9a2 appears in SCOP 1.73
  
• d1rl9a2 appears in SCOPe 2.01
  
• d1rl9a2 appears in the current release, SCOPe 2.08