Lineage for d1rl9a1 (1rl9 A:2-95)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 919067Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 919068Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (1 family) (S)
  5. 919069Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)
  6. 919070Protein Arginine kinase, N-domain [48042] (1 species)
  7. 919071Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48043] (7 PDB entries)
    Uniprot P51541
  8. 919073Domain d1rl9a1: 1rl9 A:2-95 [104979]
    Other proteins in same PDB: d1rl9a2
    complexed with adp, iom, mg

Details for d1rl9a1

PDB Entry: 1rl9 (more details), 1.45 Å

PDB Description: Crystal structure of Creatine-ADP arginine kinase ternary complex
PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d1rl9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rl9a1 a.83.1.1 (A:2-95) Arginine kinase, N-domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
dsgvgiyapdaesyrtfgplfdpiiddyhggfkl

SCOPe Domain Coordinates for d1rl9a1:

Click to download the PDB-style file with coordinates for d1rl9a1.
(The format of our PDB-style files is described here.)

Timeline for d1rl9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rl9a2