![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
![]() | Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (1 family) ![]() |
![]() | Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins) |
![]() | Protein Arginine kinase, N-domain [48042] (1 species) |
![]() | Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48043] (7 PDB entries) |
![]() | Domain d1rl9a1: 1rl9 A:2-95 [104979] Other proteins in same PDB: d1rl9a2 |
PDB Entry: 1rl9 (more details), 1.45 Å
SCOP Domain Sequences for d1rl9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rl9a1 a.83.1.1 (A:2-95) Arginine kinase, N-domain {Horseshoe crab (Limulus polyphemus)} vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl dsgvgiyapdaesyrtfgplfdpiiddyhggfkl
Timeline for d1rl9a1: