Lineage for d1rl3b1 (1rl3 B:509-644)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470565Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 470925Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families) (S)
  5. 470931Family b.82.3.2: cAMP-binding domain [51210] (6 proteins)
    Pfam 00027
  6. 470975Protein Regulatory subunit of Protein kinase A [51213] (2 species)
    duplication: consists of two similar domains
  7. 470976Species Cow (Bos taurus) [TaxId:9913] [51214] (4 PDB entries)
  8. 470985Domain d1rl3b1: 1rl3 B:509-644 [104977]

Details for d1rl3b1

PDB Entry: 1rl3 (more details), 2.7 Å

PDB Description: Crystal structure of cAMP-free R1a subunit of PKA

SCOP Domain Sequences for d1rl3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rl3b1 b.82.3.2 (B:509-644) Regulatory subunit of Protein kinase A {Cow (Bos taurus)}
asyvrkvipkdyktmaalakaieknvlfshlddnersdifdamfpvsfiagetviqqgde
gdnfyvidqgemdvyvnnewatsvgeggsfgelaliygtpraatvkaktnvklwgidrds
yrrilmgstlrkrkmy

SCOP Domain Coordinates for d1rl3b1:

Click to download the PDB-style file with coordinates for d1rl3b1.
(The format of our PDB-style files is described here.)

Timeline for d1rl3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rl3b2