SCOPe 2.08: Domain d1rl3b1: 1rl3 B:509-644

Lineage for d1rl3b1 (1rl3 B:509-644)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Regulatory subunit of Protein kinase A [51213] (2 species)
   duplication: consists of two similar domains

7. Species Cow (Bos taurus) [TaxId:9913] [51214] (5 PDB entries)
   Uniprot P00514 109-376

8. Domain d1rl3b1: 1rl3 B:509-644 [104977]
   complexed with gol, pcg

Details for d1rl3b1

PDB Entry: 1rl3, 2.7 Å

PDB Description: Crystal structure of cAMP-free R1a subunit of PKA

PDB Compounds: (B:) cAMP-dependent protein kinase type I-alpha regulatory chain

SCOPe Domain Sequences for d1rl3b1:

Sequence; same for both SEQRES and ATOM records:

>d1rl3b1 b.82.3.2 (B:509-644) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]}
asyvrkvipkdyktmaalakaieknvlfshlddnersdifdamfpvsfiagetviqqgde
gdnfyvidqgemdvyvnnewatsvgeggsfgelaliygtpraatvkaktnvklwgidrds
yrrilmgstlrkrkmy

Timeline for d1rl3b1:

• d1rl3b1 first appeared in SCOP 1.69
  
• d1rl3b1 appears in SCOPe 2.07