![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
![]() | Protein Regulatory subunit of Protein kinase A [51213] (2 species) duplication: consists of two similar domains |
![]() | Species Cow (Bos taurus) [TaxId:9913] [51214] (5 PDB entries) Uniprot P00514 109-376 |
![]() | Domain d1rl3a2: 1rl3 A:245-376 [104976] complexed with gol, pcg |
PDB Entry: 1rl3 (more details), 2.7 Å
SCOPe Domain Sequences for d1rl3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rl3a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} eeflskvsilesldkwerltvadalepvqfedgqkivvqgepgdeffiilegsaavlqrr seneefvevgrlgpsdyfgeiallmnrpraatvvargplkcvkldrprfervlgpcsdil krniqqynsfvs
Timeline for d1rl3a2: