SCOP 1.69: Domain d1rkwa2: 1rkw A:73-187

Lineage for d1rkwa2 (1rkw A:73-187)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (9 proteins)

6. Protein Multidrug binding protein QacR [69107] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [69108] (11 PDB entries)

8. Domain d1rkwa2: 1rkw A:73-187 [104968]
   Other proteins in same PDB: d1rkwa1, d1rkwb1, d1rkwd1, d1rkwe1

Details for d1rkwa2

PDB Entry: 1rkw, 2.62 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to pentamadine

SCOP Domain Sequences for d1rkwa2:

Sequence; same for both SEQRES and ATOM records:

>d1rkwa2 a.121.1.1 (A:73-187) Multidrug binding protein QacR {Staphylococcus aureus}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

Timeline for d1rkwa2:

• d1rkwa2 is new in SCOP 1.69
  
• d1rkwa2 appears in SCOP 1.71
  
• d1rkwa2 appears in the current release, SCOPe 2.08