Class a: All alpha proteins [46456] (218 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (10 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.4: Parvalbumin [47492] (2 proteins) 6-helices; array of 3 hairpins, closed made with two-helical hairpin and two EF-hands |
Protein Parvalbumin [47495] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [109818] (2 PDB entries) |
Domain d1rk9a_: 1rk9 A: [104965] |
PDB Entry: 1rk9 (more details)
SCOP Domain Sequences for d1rk9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rk9a_ a.39.1.4 (A:) Parvalbumin {Human (Homo sapiens)} msmtdllnaedikkavgafsatdsfdhkkffqmvglkkksaddvkkvfhmldkdksgfie edelgfilkgfspdardlsaketkmlmaagdkdgdgkigvdefstlvaes
Timeline for d1rk9a_: