Lineage for d1rk9a_ (1rk9 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 442523Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 442524Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 442659Family a.39.1.4: Parvalbumin [47492] (2 proteins)
    6-helices; array of 3 hairpins, closed
    made with two-helical hairpin and two EF-hands
  6. 442664Protein Parvalbumin [47495] (7 species)
  7. 442674Species Human (Homo sapiens) [TaxId:9606] [109818] (2 PDB entries)
  8. 442676Domain d1rk9a_: 1rk9 A: [104965]

Details for d1rk9a_

PDB Entry: 1rk9 (more details)

PDB Description: solution structure of human alpha-parvalbumin (minimized average structure)

SCOP Domain Sequences for d1rk9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rk9a_ a.39.1.4 (A:) Parvalbumin {Human (Homo sapiens)}
msmtdllnaedikkavgafsatdsfdhkkffqmvglkkksaddvkkvfhmldkdksgfie
edelgfilkgfspdardlsaketkmlmaagdkdgdgkigvdefstlvaes

SCOP Domain Coordinates for d1rk9a_:

Click to download the PDB-style file with coordinates for d1rk9a_.
(The format of our PDB-style files is described here.)

Timeline for d1rk9a_: