Lineage for d1rjha_ (1rjh A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3001355Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 3001807Protein Tetranectin [56465] (1 species)
    trimeric plasminogen binding protein with an alpha-helical coiled coil
  7. 3001808Species Human (Homo sapiens) [TaxId:9606] [56466] (3 PDB entries)
    Uniprot P05452 85-202
  8. 3001811Domain d1rjha_: 1rjh A: [104963]

Details for d1rjha_

PDB Entry: 1rjh (more details)

PDB Description: structure of the calcium free form of the c-type lectin-like domain of tetranectin
PDB Compounds: (A:) tetranectin

SCOPe Domain Sequences for d1rjha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjha_ d.169.1.1 (A:) Tetranectin {Human (Homo sapiens) [TaxId: 9606]}
ftqtktfheasedcisrggtlstpqtgsendalyeylrqsvgneaeiwlglndmaaegtw
vdmtgariayknweteitaqpdggktencavlsgaangkwfdkrcrdqlpyicqfgiv

SCOPe Domain Coordinates for d1rjha_:

Click to download the PDB-style file with coordinates for d1rjha_.
(The format of our PDB-style files is described here.)

Timeline for d1rjha_: