Lineage for d1rjaa_ (1rja A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965659Protein Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) [111084] (1 species)
  7. 2965660Species Human (Homo sapiens) [TaxId:9606] [111085] (1 PDB entry)
    Uniprot Q13882 75-174
  8. 2965661Domain d1rjaa_: 1rja A: [104962]

Details for d1rjaa_

PDB Entry: 1rja (more details)

PDB Description: Solution Structure and Backbone Dynamics of the Nonreceptor Tyrosine Kinase PTK6/Brk SH2 Domain
PDB Compounds: (A:) Tyrosine-protein kinase 6

SCOPe Domain Sequences for d1rjaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]}
sepwffgcisrseavrrlqaegnatgaflirvsekpsadyvlsvrdtqavrhykiwrrag
grlhlneavsflslpelvnyhraqslshglrlaapcrkhe

SCOPe Domain Coordinates for d1rjaa_:

Click to download the PDB-style file with coordinates for d1rjaa_.
(The format of our PDB-style files is described here.)

Timeline for d1rjaa_: