Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) [111084] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [111085] (1 PDB entry) Uniprot Q13882 75-174 |
Domain d1rjaa_: 1rja A: [104962] |
PDB Entry: 1rja (more details)
SCOPe Domain Sequences for d1rjaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} sepwffgcisrseavrrlqaegnatgaflirvsekpsadyvlsvrdtqavrhykiwrrag grlhlneavsflslpelvnyhraqslshglrlaapcrkhe
Timeline for d1rjaa_: