![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
![]() | Protein Dbl's big sister, Dbs [74989] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [74990] (4 PDB entries) SQ Q64096 624-958 # 98% sequence identity; the rat sequence Q63406 region 499-833 is 100% identical to the PDB sequence |
![]() | Domain d1rj2j2: 1rj2 J:819-952 [104961] Other proteins in same PDB: d1rj2a1, d1rj2d1, d1rj2g1, d1rj2j1 |
PDB Entry: 1rj2 (more details), 3 Å
SCOPe Domain Sequences for d1rj2j2:
Sequence, based on SEQRES records: (download)
>d1rj2j2 b.55.1.1 (J:819-952) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} tgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqrhlflhekavlfckkree ngegyekapsysykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawv neirkvltsqlqac
>d1rj2j2 b.55.1.1 (J:819-952) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} tgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqrhlflhekavlfckkrey sykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawvneirkvltsql qac
Timeline for d1rj2j2: