SCOPe 2.05: Domain d1rj2j1: 1rj2 J:624-818

Lineage for d1rj2j1 (1rj2 J:624-818)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
   multihelical; core: 5-helical bundle

4. Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families)
   automatically mapped to Pfam PF00621

5. Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
   Pfam PF00621

6. Protein Dbl's big sister, Dbs [74743] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [74744] (4 PDB entries)
   Uniprot Q64096 624-958 # 98% sequence identity; the rat sequence Q63406 region 499-833 is 100% identical to the PDB sequence

8. Domain d1rj2j1: 1rj2 J:624-818 [104960]
   Other proteins in same PDB: d1rj2a2, d1rj2d2, d1rj2g2, d1rj2j2

Details for d1rj2j1

PDB Entry: 1rj2, 3 Å

PDB Description: Crystal structure of the DH/PH fragment of Dbs without bound GTPase

PDB Compounds: (J:) Guanine nucleotide exchange factor DBS [Fragment]

SCOPe Domain Sequences for d1rj2j1:

Sequence; same for both SEQRES and ATOM records:

>d1rj2j1 a.87.1.1 (J:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}
eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
gilkavndsmhliai

Timeline for d1rj2j1:

• d1rj2j1 first appeared in SCOP 1.69
  
• d1rj2j1 appears in SCOPe 2.04
  
• d1rj2j1 appears in SCOPe 2.06
  
• d1rj2j1 appears in the current release, SCOPe 2.08