Lineage for d1rima_ (1rim A:)

  1. Root: SCOPe 2.08
  2. 3047812Class k: Designed proteins [58788] (44 folds)
  3. 3048037Fold k.12: Zinc finger design [58856] (1 superfamily)
  4. 3048038Superfamily k.12.1: Zinc finger design [58857] (1 family) (S)
  5. 3048039Family k.12.1.1: Zinc finger design [58858] (7 proteins)
  6. 3048049Protein E6-binding zinc finger, different constructs [111544] (1 species)
  7. 3048050Species Synthetic [111545] (2 PDB entries)
  8. 3048052Domain d1rima_: 1rim A: [104953]

Details for d1rima_

PDB Entry: 1rim (more details)

PDB Description: e6-binding zinc finger (e6apc2)
PDB Compounds: (A:) E6apc2 peptide

SCOPe Domain Sequences for d1rima_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rima_ k.12.1.1 (A:) E6-binding zinc finger, different constructs {Synthetic}
ykfacpecpkrfmrsdhlskhitlhellgeerr

SCOPe Domain Coordinates for d1rima_:

Click to download the PDB-style file with coordinates for d1rima_.
(The format of our PDB-style files is described here.)

Timeline for d1rima_: