SCOPe 2.08: Domain d1rida4: 1rid A:185-244

Lineage for d1rida4 (1rid A:185-244)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Complement control protein [57539] (1 species)

7. Species Vaccinia virus [TaxId:10245] [57540] (8 PDB entries)
   Uniprot P10998
   a complement protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans

8. Domain d1rida4: 1rid A:185-244 [104946]
   complexed with ids, sgn

Details for d1rida4

PDB Entry: 1rid, 2.1 Å

PDB Description: vaccinia complement protein in complex with heparin

PDB Compounds: (A:) complement control protein

SCOPe Domain Sequences for d1rida4:

Sequence; same for both SEQRES and ATOM records:

>d1rida4 g.18.1.1 (A:185-244) Complement control protein {Vaccinia virus [TaxId: 10245]}
vkcphptisngylssgfkrsysyndnvdfkckygyklsgsssstcspgntwkpelpkcvr

Timeline for d1rida4:

• d1rida4 first appeared in SCOP 1.69
  
• d1rida4 appears in SCOPe 2.07