Lineage for d1rh7f_ (1rh7 F:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 525056Fold g.77: Resistin (Pfam 06954) [111422] (1 superfamily)
    disulfide-rich six-stranded beta-sandwich; jelly-roll
  4. 525057Superfamily g.77.1: Resistin (Pfam 06954) [111423] (1 family) (S)
  5. 525058Family g.77.1.1: Resistin (Pfam 06954) [111424] (2 proteins)
  6. 525067Protein Resistin-like beta (FIZZ2) [111427] (1 species)
  7. 525068Species Mouse (Mus musculus) [TaxId:10090] [111428] (1 PDB entry)
  8. 525074Domain d1rh7f_: 1rh7 F: [104942]

Details for d1rh7f_

PDB Entry: 1rh7 (more details), 3.11 Å

PDB Description: crystal structure of resistin-like beta

SCOP Domain Sequences for d1rh7f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rh7f_ g.77.1.1 (F:) Resistin-like beta (FIZZ2) {Mouse (Mus musculus)}
csfeslvdqrikealsrqepktisctsvtssgrlascpagmvvtgcacgygcgswdirng
ntchcqcsvmdwasarccrma

SCOP Domain Coordinates for d1rh7f_:

Click to download the PDB-style file with coordinates for d1rh7f_.
(The format of our PDB-style files is described here.)

Timeline for d1rh7f_: