Lineage for d1rh6a_ (1rh6 A:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636570Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 636571Superfamily a.6.1: Putative DNA-binding domain [46955] (7 families) (S)
  5. 636641Family a.6.1.7: Excisionase-like [46891] (2 proteins)
    kinked C-terminal helix
  6. 636642Protein Excisionase Xis [89004] (1 species)
  7. 636643Species Bacteriophage lambda [TaxId:10710] [89005] (5 PDB entries)
  8. 636644Domain d1rh6a_: 1rh6 A: [104935]

Details for d1rh6a_

PDB Entry: 1rh6 (more details), 1.7 Å

PDB Description: bacteriophage lambda excisionase (xis)-dna complex
PDB Compounds: (A:) Excisionase

SCOP Domain Sequences for d1rh6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rh6a_ a.6.1.7 (A:) Excisionase Xis {Bacteriophage lambda [TaxId: 10710]}
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrp

SCOP Domain Coordinates for d1rh6a_:

Click to download the PDB-style file with coordinates for d1rh6a_.
(The format of our PDB-style files is described here.)

Timeline for d1rh6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rh6b_