Lineage for d1rgxc_ (1rgx C:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643344Fold g.77: Resistin [111422] (1 superfamily)
    disulfide-rich six-stranded beta-sandwich; jelly-roll
  4. 2643345Superfamily g.77.1: Resistin [111423] (1 family) (S)
    automatically mapped to Pfam PF06954
  5. 2643346Family g.77.1.1: Resistin [111424] (2 proteins)
    Pfam PF06954
  6. 2643347Protein Resistin (ADSF, FIZZ3) [111425] (1 species)
  7. 2643348Species Mouse (Mus musculus) [TaxId:10090] [111426] (2 PDB entries)
    Uniprot Q99P87 26-114
  8. 2643351Domain d1rgxc_: 1rgx C: [104934]
    contains alpha-helical oligomerization subdomain(26-51; trimeric right-handed coiled coil)

Details for d1rgxc_

PDB Entry: 1rgx (more details), 1.79 Å

PDB Description: crystal structure of resisitin
PDB Compounds: (C:) Resistin

SCOPe Domain Sequences for d1rgxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgxc_ g.77.1.1 (C:) Resistin (ADSF, FIZZ3) {Mouse (Mus musculus) [TaxId: 10090]}
ssmplcpideaidkkikqdfnslfpnaikniglncwtvssrgklascpegtavlscscgs
acgswdireekvchcqcaridwtaarccklqvas

SCOPe Domain Coordinates for d1rgxc_:

Click to download the PDB-style file with coordinates for d1rgxc_.
(The format of our PDB-style files is described here.)

Timeline for d1rgxc_: