Lineage for d1rgxa_ (1rgx A:)

  1. Root: SCOP 1.69
  2. 520835Class g: Small proteins [56992] (75 folds)
  3. 525056Fold g.77: Resistin (Pfam 06954) [111422] (1 superfamily)
    disulfide-rich six-stranded beta-sandwich; jelly-roll
  4. 525057Superfamily g.77.1: Resistin (Pfam 06954) [111423] (1 family) (S)
  5. 525058Family g.77.1.1: Resistin (Pfam 06954) [111424] (2 proteins)
  6. 525059Protein Resistin (ADSF, FIZZ3) [111425] (1 species)
  7. 525060Species Mouse (Mus musculus) [TaxId:10090] [111426] (2 PDB entries)
  8. 525061Domain d1rgxa_: 1rgx A: [104932]

Details for d1rgxa_

PDB Entry: 1rgx (more details), 1.79 Å

PDB Description: crystal structure of resisitin

SCOP Domain Sequences for d1rgxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgxa_ g.77.1.1 (A:) Resistin (ADSF, FIZZ3) {Mouse (Mus musculus)}
cpideaidkkikqdfnslfpnaikniglncwtvssrgklascpegtavlscscgsacgsw
direekvchcqcaridwtaarccklqvas

SCOP Domain Coordinates for d1rgxa_:

Click to download the PDB-style file with coordinates for d1rgxa_.
(The format of our PDB-style files is described here.)

Timeline for d1rgxa_: