Class g: Small proteins [56992] (100 folds) |
Fold g.77: Resistin [111422] (1 superfamily) disulfide-rich six-stranded beta-sandwich; jelly-roll |
Superfamily g.77.1: Resistin [111423] (2 families) automatically mapped to Pfam PF06954 |
Family g.77.1.1: Resistin [111424] (2 proteins) Pfam PF06954 |
Protein Resistin (ADSF, FIZZ3) [111425] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [111426] (2 PDB entries) Uniprot Q99P87 26-114 |
Domain d1rgxa_: 1rgx A: [104932] contains alpha-helical oligomerization subdomain(26-51; trimeric right-handed coiled coil) |
PDB Entry: 1rgx (more details), 1.79 Å
SCOPe Domain Sequences for d1rgxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rgxa_ g.77.1.1 (A:) Resistin (ADSF, FIZZ3) {Mouse (Mus musculus) [TaxId: 10090]} cpideaidkkikqdfnslfpnaikniglncwtvssrgklascpegtavlscscgsacgsw direekvchcqcaridwtaarccklqvas
Timeline for d1rgxa_: