Lineage for d1rgig1 (1rgi G:26-152)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576227Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2576228Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2576229Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2576230Protein Gelsolin [55759] (2 species)
    consists of six similar domains
  7. 2576231Species Horse (Equus caballus) [TaxId:9796] [55760] (2 PDB entries)
    Uniprot Q28372 1-346
  8. 2576244Domain d1rgig1: 1rgi G:26-152 [104928]
    Other proteins in same PDB: d1rgia1, d1rgia2
    complexed with atp, ca

Details for d1rgig1

PDB Entry: 1rgi (more details), 3 Å

PDB Description: crystal structure of gelsolin domains g1-g3 bound to actin
PDB Compounds: (G:) gelsolin

SCOPe Domain Sequences for d1rgig1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rgig1 d.109.1.1 (G:26-152) Gelsolin {Horse (Equus caballus) [TaxId: 9796]}
vvehpeflkagkepglqiwrvekfdlvpvppnlygdfftgdayvilktvqlrngilqydl
hywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggv
asgfkhv

SCOPe Domain Coordinates for d1rgig1:

Click to download the PDB-style file with coordinates for d1rgig1.
(The format of our PDB-style files is described here.)

Timeline for d1rgig1: