SCOP 1.73: Domain d1rg0b_: 1rg0 B:

Lineage for d1rg0b_ (1rg0 B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (4 families)
   bacterial filament proteins

5. Family d.24.1.1: Pilin [54524] (4 proteins)

6. Protein Pilin P1 [109619] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [64247] (3 PDB entries)

8. Domain d1rg0b_: 1rg0 B: [104923]

Details for d1rg0b_

PDB Entry: 1rg0, 1.8 Å

PDB Description: Monoclinic crystal form of the truncated K122-4 pilin from Pseudomonas aeruginosa

PDB Compounds: (B:) fimbrial protein

SCOP Domain Sequences for d1rg0b_:

Sequence; same for both SEQRES and ATOM records:

>d1rg0b_ d.24.1.1 (B:) Pilin P1 {Pseudomonas aeruginosa [TaxId: 287]}
isefaraqlseamtlasglktkvsdifsqdgscpantaatagiekdtdingkyvakvttg
gtaaasggctivatmkasdvatplrgktltltlgnadkgsytwactsnadnkylpktcqt
attttp

Timeline for d1rg0b_:

• d1rg0b_ first appeared in SCOP 1.69
  
• d1rg0b_ appears in SCOP 1.71
  
• d1rg0b_ appears in SCOP 1.75
  
• d1rg0b_ appears in the current release, SCOPe 2.08, called d1rg0b1