Lineage for d1rg0b_ (1rg0 B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600978Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 600979Superfamily d.24.1: Pili subunits [54523] (3 families) (S)
    bacterial filament proteins
  5. 600980Family d.24.1.1: Pilin [54524] (4 proteins)
  6. 600985Protein Pilin P1 [109619] (1 species)
  7. 600986Species Pseudomonas aeruginosa [TaxId:287] [64247] (3 PDB entries)
  8. 600990Domain d1rg0b_: 1rg0 B: [104923]

Details for d1rg0b_

PDB Entry: 1rg0 (more details), 1.8 Å

PDB Description: Monoclinic crystal form of the truncated K122-4 pilin from Pseudomonas aeruginosa

SCOP Domain Sequences for d1rg0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rg0b_ d.24.1.1 (B:) Pilin P1 {Pseudomonas aeruginosa}
isefaraqlseamtlasglktkvsdifsqdgscpantaatagiekdtdingkyvakvttg
gtaaasggctivatmkasdvatplrgktltltlgnadkgsytwactsnadnkylpktcqt
attttp

SCOP Domain Coordinates for d1rg0b_:

Click to download the PDB-style file with coordinates for d1rg0b_.
(The format of our PDB-style files is described here.)

Timeline for d1rg0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rg0a_