Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.24: Pili subunits [54522] (1 superfamily) contains very long N-terminal helix, which end is packed against beta-sheet |
Superfamily d.24.1: Pili subunits [54523] (8 families) bacterial filament proteins |
Family d.24.1.1: Pilin [54524] (5 proteins) |
Protein Pilin P1 [109619] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [64247] (3 PDB entries) Uniprot P17838 36-147 |
Domain d1rg0b1: 1rg0 B:29-150 [104923] Other proteins in same PDB: d1rg0a2, d1rg0b2 |
PDB Entry: 1rg0 (more details), 1.8 Å
SCOPe Domain Sequences for d1rg0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rg0b1 d.24.1.1 (B:29-150) Pilin P1 {Pseudomonas aeruginosa [TaxId: 287]} araqlseamtlasglktkvsdifsqdgscpantaatagiekdtdingkyvakvttggtaa asggctivatmkasdvatplrgktltltlgnadkgsytwactsnadnkylpktcqtattt tp
Timeline for d1rg0b1: