Lineage for d1rg0a1 (1rg0 A:29-150)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185566Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2185567Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2185568Family d.24.1.1: Pilin [54524] (5 proteins)
  6. 2185573Protein Pilin P1 [109619] (1 species)
  7. 2185574Species Pseudomonas aeruginosa [TaxId:287] [64247] (3 PDB entries)
    Uniprot P17838 36-147
  8. 2185577Domain d1rg0a1: 1rg0 A:29-150 [104922]
    Other proteins in same PDB: d1rg0a2, d1rg0b2

Details for d1rg0a1

PDB Entry: 1rg0 (more details), 1.8 Å

PDB Description: Monoclinic crystal form of the truncated K122-4 pilin from Pseudomonas aeruginosa
PDB Compounds: (A:) fimbrial protein

SCOPe Domain Sequences for d1rg0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rg0a1 d.24.1.1 (A:29-150) Pilin P1 {Pseudomonas aeruginosa [TaxId: 287]}
araqlseamtlasglktkvsdifsqdgscpantaatagiekdtdingkyvakvttggtaa
asggctivatmkasdvatplrgktltltlgnadkgsytwactsnadnkylpktcqtattt
tp

SCOPe Domain Coordinates for d1rg0a1:

Click to download the PDB-style file with coordinates for d1rg0a1.
(The format of our PDB-style files is described here.)

Timeline for d1rg0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rg0a2