SCOPe 2.05: Domain d1rg0a_: 1rg0 A:

Lineage for d1rg0a_ (1rg0 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (8 families)
   bacterial filament proteins

5. Family d.24.1.1: Pilin [54524] (5 proteins)

6. Protein Pilin P1 [109619] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [64247] (3 PDB entries)
   Uniprot P17838 36-147

8. Domain d1rg0a_: 1rg0 A: [104922]

Details for d1rg0a_

PDB Entry: 1rg0, 1.8 Å

PDB Description: Monoclinic crystal form of the truncated K122-4 pilin from Pseudomonas aeruginosa

PDB Compounds: (A:) fimbrial protein

SCOPe Domain Sequences for d1rg0a_:

Sequence; same for both SEQRES and ATOM records:

>d1rg0a_ d.24.1.1 (A:) Pilin P1 {Pseudomonas aeruginosa [TaxId: 287]}
isefaraqlseamtlasglktkvsdifsqdgscpantaatagiekdtdingkyvakvttg
gtaaasggctivatmkasdvatplrgktltltlgnadkgsytwactsnadnkylpktcqt
attttp

Timeline for d1rg0a_:

• d1rg0a_ first appeared in SCOP 1.69
  
• d1rg0a_ appears in SCOPe 2.04
  
• d1rg0a_ is called d1rg0a1 in SCOPe 2.06
  
• d1rg0a_ appears in the current release, SCOPe 2.08, called d1rg0a1