Lineage for d1rfxa_ (1rfx A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 625676Fold g.77: Resistin [111422] (1 superfamily)
    disulfide-rich six-stranded beta-sandwich; jelly-roll
  4. 625677Superfamily g.77.1: Resistin [111423] (1 family) (S)
  5. 625678Family g.77.1.1: Resistin [111424] (2 proteins)
    Pfam 06954
  6. 625679Protein Resistin (ADSF, FIZZ3) [111425] (1 species)
  7. 625680Species Mouse (Mus musculus) [TaxId:10090] [111426] (2 PDB entries)
  8. 625684Domain d1rfxa_: 1rfx A: [104919]

Details for d1rfxa_

PDB Entry: 1rfx (more details), 2 Å

PDB Description: crystal structure of resisitin

SCOP Domain Sequences for d1rfxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rfxa_ g.77.1.1 (A:) Resistin (ADSF, FIZZ3) {Mouse (Mus musculus)}
cpideaidkkikqdfnslfpnaikniglncwtvssrgklascpegtavlscscgsacgsw
direekvchcqcaridwtaarccklqvas

SCOP Domain Coordinates for d1rfxa_:

Click to download the PDB-style file with coordinates for d1rfxa_.
(The format of our PDB-style files is described here.)

Timeline for d1rfxa_: