Lineage for d1rfja_ (1rfj A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1733796Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 1733853Protein Calmodulin [47516] (12 species)
  7. 1734144Species Potato (Solanum tuberosum) [TaxId:4113] [109820] (1 PDB entry)
  8. 1734145Domain d1rfja_: 1rfj A: [104918]
    complexed with ca, mpd

Details for d1rfja_

PDB Entry: 1rfj (more details), 2 Å

PDB Description: crystal structure of potato calmodulin pcm6
PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d1rfja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rfja_ a.39.1.5 (A:) Calmodulin {Potato (Solanum tuberosum) [TaxId: 4113]}
madqltedqisefkeafslfdkdgdgcittkelgtvmrslgqnpteaelqdminevdadg
ngtidfpeflnlmarkmkdtdseeelkeafrvfdkdqngfisaaelrhvmtnlgekltde
evdemireadvdgdgqinydefvkvmma

SCOPe Domain Coordinates for d1rfja_:

Click to download the PDB-style file with coordinates for d1rfja_.
(The format of our PDB-style files is described here.)

Timeline for d1rfja_: