Lineage for d1rf3a1 (1rf3 A:350-504)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2368843Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2368844Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 2368845Family b.8.1.1: MATH domain [49600] (5 proteins)
    automatically mapped to Pfam PF00917
  6. 2368911Protein TNF receptor associated factor 3 (TRAF3) [49603] (1 species)
  7. 2368912Species Human (Homo sapiens) [TaxId:9606] [49604] (5 PDB entries)
    Uniprot Q13114 377-568
  8. 2368919Domain d1rf3a1: 1rf3 A:350-504 [104915]
    Other proteins in same PDB: d1rf3a2, d1rf3b_

Details for d1rf3a1

PDB Entry: 1rf3 (more details), 3.5 Å

PDB Description: structurally distinct recognition motifs in lymphotoxin-b receptor and cd40 for traf-mediated signaling
PDB Compounds: (A:) tnf receptor associated factor 3

SCOPe Domain Sequences for d1rf3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rf3a1 b.8.1.1 (A:350-504) TNF receptor associated factor 3 (TRAF3) {Human (Homo sapiens) [TaxId: 9606]}
yngvliwkirdykrrkqeavmgktlslysqpfytgyfgykmcarvylngdgmgkgthlsl
ffvimrgeydallpwpfkqkvtlmlmdqgssrrhlgdafkpdpnsssfkkptgemniasg
cpvfvaqtvlengtyikddtifikvivdtsdlpdp

SCOPe Domain Coordinates for d1rf3a1:

Click to download the PDB-style file with coordinates for d1rf3a1.
(The format of our PDB-style files is described here.)

Timeline for d1rf3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rf3a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1rf3b_