Lineage for d1re5c_ (1re5 C:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 448525Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 448526Superfamily a.127.1: L-aspartase-like [48557] (2 families) (S)
  5. 448527Family a.127.1.1: L-aspartase/fumarase [48558] (5 proteins)
  6. 448528Protein 3-carboxy-cis,cis-muconate cycloisomerase (CMLE) [101444] (2 species)
  7. 448531Species Pseudomonas putida, strain KT2440 [TaxId:303] [110023] (1 PDB entry)
  8. 448534Domain d1re5c_: 1re5 C: [104913]

Details for d1re5c_

PDB Entry: 1re5 (more details), 2.6 Å

PDB Description: Crystal structure of 3-carboxy-cis,cis-muconate lactonizing enzyme from Pseudomonas putida

SCOP Domain Sequences for d1re5c_:

Sequence, based on SEQRES records: (download)

>d1re5c_ a.127.1.1 (C:) 3-carboxy-cis,cis-muconate cycloisomerase (CMLE) {Pseudomonas putida, strain KT2440}
nqlfdayftapamreifsdrgrlqgmldfeaalaraeasaglvphsavaaieaacqaery
dtgalanaiatagnsaiplvkalgkviatgvpeaeryvhlgatsqdamdtglvlqlrdal
dlieadlgkladtlsqqalkhadtplvgrtwlqhatpvtlgmklagvlgaltrhrqrlqe
lrprllvlqfggasgslaalgskampvaealaeqlkltlpeqpwhtqrdrlvefasvlgl
vagslgkfgrdisllmqteagevfepsapgkggsstmphkrnpvgaavligaatrvpgll
stlfaampqeherslglwhaewetlpdicclvsgalrqaqviaegmevdaarmrrnldlt
qglvlaeavsivlaqrlgrdrahhlleqccqravaeqrhlravlgdepqvsaelsgeeld
rlldpahylgqarvwvaravsehqrfta

Sequence, based on observed residues (ATOM records): (download)

>d1re5c_ a.127.1.1 (C:) 3-carboxy-cis,cis-muconate cycloisomerase (CMLE) {Pseudomonas putida, strain KT2440}
nqlfdayftapamreifsdrgrlqgmldfeaalaraeasaglvphsavaaieaacqaery
dtgalanaiatagnsaiplvkalgkviatgvpeaeryvhlgatsqdamdtglvlqlrdal
dlieadlgkladtlsqqalkhadtplvgrtwlqhatpvtlgmklagvlgaltrhrqrlqe
lrprllvlqfggasgslaalgskampvaealaeqlkltlpeqpwhtqrdrlvefasvlgl
vagslgkfgrdisllmqteagevfepstmphkrnpvgaavligaatrvpgllstlfaamp
qeherslglwhaewetlpdicclvsgalrqaqviaegmevdaarmrrnldltqglvlaea
vsivlaqrlgrdrahhlleqccqravaeqrhlravlgdepqvsaelsgeeldrlldpahy
lgqarvwvaravsehqrfta

SCOP Domain Coordinates for d1re5c_:

Click to download the PDB-style file with coordinates for d1re5c_.
(The format of our PDB-style files is described here.)

Timeline for d1re5c_: