Lineage for d1re4c2 (1re4 C:106-141)

  1. Root: SCOP 1.69
  2. 525081Class h: Coiled coil proteins [57942] (6 folds)
  3. 525082Fold h.1: Parallel coiled-coil [57943] (28 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 525512Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 525513Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 525608Protein Fibrinogen gamma chain [88898] (4 species)
  7. 525617Species Human (Homo sapiens) [TaxId:9606] [88900] (15 PDB entries)
  8. 525628Domain d1re4c2: 1re4 C:106-141 [104905]
    Other proteins in same PDB: d1re4a_, d1re4b1, d1re4b2, d1re4c1, d1re4d_, d1re4e1, d1re4e2, d1re4f1

Details for d1re4c2

PDB Entry: 1re4 (more details), 2.7 Å

PDB Description: crystal structure of fragment d of bbetad398a fibrinogen

SCOP Domain Sequences for d1re4c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1re4c2 h.1.8.1 (C:106-141) Fibrinogen gamma chain {Human (Homo sapiens)}
sirylqeiynsnnqkivnlkekvaqleaqcqepckd

SCOP Domain Coordinates for d1re4c2:

Click to download the PDB-style file with coordinates for d1re4c2.
(The format of our PDB-style files is described here.)

Timeline for d1re4c2:

525628
d1re4c2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1re4c1