Class h: Coiled coil proteins [57942] (6 folds) |
Fold h.1: Parallel coiled-coil [57943] (28 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
Protein Fibrinogen beta chain [88892] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries) |
Domain d1re4b2: 1re4 B:165-199 [104903] Other proteins in same PDB: d1re4a_, d1re4b1, d1re4c1, d1re4c2, d1re4d_, d1re4e1, d1re4f1, d1re4f2 |
PDB Entry: 1re4 (more details), 2.7 Å
SCOP Domain Sequences for d1re4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1re4b2 h.1.8.1 (B:165-199) Fibrinogen beta chain {Human (Homo sapiens)} lrvlrsilenlrskiqklesdvsaqmeycrtpctv
Timeline for d1re4b2: