Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) |
Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins) in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails |
Protein Fibrinogen beta chain [88892] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88895] (15 PDB entries) Uniprot P02675 |
Domain d1re3e2: 1re3 E:165-199 [104898] Other proteins in same PDB: d1re3a_, d1re3b1, d1re3c1, d1re3c2, d1re3d_, d1re3e1, d1re3f1, d1re3f2 complexed with ca |
PDB Entry: 1re3 (more details), 2.45 Å
SCOPe Domain Sequences for d1re3e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1re3e2 h.1.8.1 (E:165-199) Fibrinogen beta chain {Human (Homo sapiens) [TaxId: 9606]} lrvlrsilenlrskiqklesdvsaqmeycrtpctv
Timeline for d1re3e2: