Lineage for d1re3e1 (1re3 E:200-458)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3002834Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 3002835Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 3002836Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
    automatically mapped to Pfam PF00147
  6. 3002837Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 3002844Species Human (Homo sapiens), beta [TaxId:9606] [68903] (14 PDB entries)
    Uniprot P02675
  8. 3002850Domain d1re3e1: 1re3 E:200-458 [104897]
    Other proteins in same PDB: d1re3a_, d1re3b2, d1re3c2, d1re3d_, d1re3e2, d1re3f2
    complexed with ca

Details for d1re3e1

PDB Entry: 1re3 (more details), 2.45 Å

PDB Description: crystal structure of fragment d of bbetad398a fibrinogen with the peptide ligand gly-his-arg-pro-amide
PDB Compounds: (E:) fibrinogen beta chain

SCOPe Domain Sequences for d1re3e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1re3e1 d.171.1.1 (E:200-458) Fibrinogen C-terminal domains {Human (Homo sapiens), beta [TaxId: 9606]}
scnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgs
vdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkg
dkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstyd
rdndgwltsdprkqcskeagggwwynrchaanpngryywggqytwdmakhgtddgvvwmn
wkgswysmrkmsmkirpff

SCOPe Domain Coordinates for d1re3e1:

Click to download the PDB-style file with coordinates for d1re3e1.
(The format of our PDB-style files is described here.)

Timeline for d1re3e1: