SCOPe 2.08: Domain d1re3c2: 1re3 C:106-141

Lineage for d1re3c2 (1re3 C:106-141)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families)

5. Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
   in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails

6. Protein Fibrinogen gamma chain [88898] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88900] (18 PDB entries)
   Uniprot P02679

8. Domain d1re3c2: 1re3 C:106-141 [104895]
   Other proteins in same PDB: d1re3a_, d1re3b1, d1re3b2, d1re3c1, d1re3d_, d1re3e1, d1re3e2, d1re3f1
   complexed with ca

Details for d1re3c2

PDB Entry: 1re3, 2.45 Å

PDB Description: crystal structure of fragment d of bbetad398a fibrinogen with the peptide ligand gly-his-arg-pro-amide

PDB Compounds: (C:) Fibrinogen gamma chain

SCOPe Domain Sequences for d1re3c2:

Sequence; same for both SEQRES and ATOM records:

>d1re3c2 h.1.8.1 (C:106-141) Fibrinogen gamma chain {Human (Homo sapiens) [TaxId: 9606]}
sirylqeiynsnnqkivnlkekvaqleaqcqepckd

Timeline for d1re3c2:

• d1re3c2 first appeared in SCOP 1.69
  
• d1re3c2 appears in SCOPe 2.07