Lineage for d1re3a_ (1re3 A:)

  1. Root: SCOPe 2.05
  2. 1968223Class h: Coiled coil proteins [57942] (7 folds)
  3. 1968224Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 1968888Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (2 families) (S)
  5. 1968889Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (3 proteins)
    in the central region two triple coiled-coils are stacked end-to-end and interlock with N-terminal tails
  6. 1968890Protein Fibrinogen alpha chain [88887] (4 species)
  7. 1968899Species Human (Homo sapiens) [TaxId:9606] [88889] (22 PDB entries)
    Uniprot P02671 150-209
  8. 1968905Domain d1re3a_: 1re3 A: [104891]
    Other proteins in same PDB: d1re3b1, d1re3b2, d1re3c1, d1re3c2, d1re3e1, d1re3e2, d1re3f1, d1re3f2
    complexed with ca

Details for d1re3a_

PDB Entry: 1re3 (more details), 2.45 Å

PDB Description: crystal structure of fragment d of bbetad398a fibrinogen with the peptide ligand gly-his-arg-pro-amide
PDB Compounds: (A:) Fibrinogen alpha/alpha-E Chain

SCOPe Domain Sequences for d1re3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1re3a_ h.1.8.1 (A:) Fibrinogen alpha chain {Human (Homo sapiens) [TaxId: 9606]}
qhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkqleqvia

SCOPe Domain Coordinates for d1re3a_:

Click to download the PDB-style file with coordinates for d1re3a_.
(The format of our PDB-style files is described here.)

Timeline for d1re3a_: