Lineage for d1rdfe_ (1rdf E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2919616Family c.108.1.3: Phosphonoacetaldehyde hydrolase-like [56792] (3 proteins)
    the insertion subdomain is a 4-helical bundle
  6. 2919617Protein Phosphonoacetaldehyde hydrolase [56793] (1 species)
  7. 2919618Species Bacillus cereus [TaxId:1396] [56794] (6 PDB entries)
    Uniprot O31156
  8. 2919631Domain d1rdfe_: 1rdf E: [104888]
    complexed with esa, mg; mutant

Details for d1rdfe_

PDB Entry: 1rdf (more details), 2.8 Å

PDB Description: g50p mutant of phosphonoacetaldehyde hydrolase in complex with substrate analogue vinyl sulfonate
PDB Compounds: (E:) phosphonoacetaldehyde hydrolase

SCOPe Domain Sequences for d1rdfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rdfe_ c.108.1.3 (E:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]}
kieavifdwagttvdygcfaplevfmeifhkrgvaitaeearkpmpllkidhvraltemp
riasewnrvfrqlpteadiqemyeefeeilfailpryaspinavkeviaslrergikigs
ttgytremmdivakeaalqgykpdflvtpddvpagrpypwmcyknamelgvypmnhmikv
gdtvsdmkegrnagmwtvgvilgsselglteeevenmdsvelrekievvrnrfvengahf
tietmqelesvmehiekqeliis

SCOPe Domain Coordinates for d1rdfe_:

Click to download the PDB-style file with coordinates for d1rdfe_.
(The format of our PDB-style files is described here.)

Timeline for d1rdfe_: